Recombinant Human Ubiquitin-conjugating enzyme E2 S (UBE2S)

Product Description

Recombinant Human Ubiquitin-conjugating enzyme E2 S (UBE2S) is available at Gentaur for Next week Delivery.

Gene Name: UBE2S

Alternative Names : E2 ubiquitin-conjugating enzyme S E2-EPF Ubiquitin carrier protein S Ubiquitin-conjugating enzyme E2-24KDA Ubiquitin-conjugating enzyme E2-EPF5 Ubiquitin-protein ligase S

Expression Region : 1-222aa

AA Sequence : MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 50.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Also acts by elongating ubiquitin chains initiated by the E2 enzyme UBE2D1/UBCH5 in vitro; it is however unclear whether UBE2D1/UBCH5 acts as an E2 enzyme for the APC/C in vivo. Also involved in ubiquitination and subsequent degradation of VHL, resulting in an accumulation of HIF1A. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, except 'Lys-48'-linked polyubiquitination.

Function : Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins

Involvement in disease :

Subcellular location :

Protein Families : Ubiquitin-conjugating enzyme family

Tissue Specificity :

Paythway : Ubiquitinmediatedproteolysis

Uniprot ID : Q16763