Recombinant Human Ubiquitin-conjugating enzyme E2 W (UBE2W)

Product Description

Recombinant Human Ubiquitin-conjugating enzyme E2 W (UBE2W) is available at Gentaur for Next week Delivery.

Gene Name: UBE2W

Alternative Names : N-terminus-conjugating E2Ubiquitin carrier protein WUbiquitin-conjugating enzyme 16;UBC-16Ubiquitin-protein ligase W

Expression Region : 1-151aa

AA Sequence : MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3. After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi ania complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Transfers ubiquitin in complex with RING/U-box type E3s that do not have active site cysteine residues to form thioester bonds with ubiquitin, and preferentially ubiquitinates the N-terminus of substrates, such as ATXN3, STUB1 and SUMO2.

Function : Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Ubiquitin-conjugating enzyme family

Tissue Specificity : Widely expressed, with highest expression in brain, liver, pancreas and heart.

Paythway : Ubiquitinmediatedproteolysis

Uniprot ID : Q96B02