Recombinant Human UL16-binding protein 2 (ULBP2), partial (Active)

Product Description

Recombinant Human UL16-binding protein 2 (ULBP2), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: ULBP2

Alternative Names : NKG2D Ligand 2; N2DL-2; NKG2DL2; ALCAN-Alpha; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; ULBP2; N2DL2; RAET1H

Expression Region : 26-217aa

AA Sequence : GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Sequence Info : Partial

Tag Info : C-terminal FC-tagged

Theoretical MW : 51.4 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human ULBP-2 in functional ELISA is less than 30 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : NKG2D Ligand 2 (N2DL2) is a member of a family of cell-surface proteins. N2DL2 function as ligands for human cytomegalovirus glycoprotein UL16. N2DL2 is anchored to the membrane via a GPI-linkage. N2DL2 is bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, T cells. Engagement of NKG2D results in the activation of cytolytic activity and cytokine production by these effects cells. The ULBPs are expressed on some tumor cells and have been implicated in tumor surveillance.

Function : Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Endoplasmic reticulum, Secreted

Protein Families : MHC class I family

Tissue Specificity : Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.

Paythway : Naturalkillercellmediatedcytotoxicity

Uniprot ID : Q9BZM5