Recombinant Human Uncharacterized protein C11orf73 (C11orf73)

Product Description

Recombinant Human Uncharacterized protein C11orf73 (C11orf73) is available at Gentaur for Next week Delivery.

Gene Name: C11orf73

Alternative Names :

Expression Region : 1-197aa

AA Sequence : MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 37.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus.

Function : Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress

Involvement in disease : Leukodystrophy, hypomyelinating, 13 (HLD13)

Subcellular location : Cytoplasm, cytosol, Nucleus

Protein Families : OPI10 family

Tissue Specificity :

Paythway :

Uniprot ID : Q53FT3