Euro
British Pound
US Dollar
Product Description
Recombinant Human Uncharacterized protein KIAA1377 (KIAA1377), partial is available at Gentaur for Next week Delivery.
Gene Name: KIAA1377
Alternative Names :
Expression Region : 559-670aa
AA Sequence : HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 28.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Participates in cytokinesis . Necessary for microtubules and mitotic spindle organization . Involved in primary cilium formation .
Function : Participates in cytokinesis
Involvement in disease :
Subcellular location : Midbody, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, cilium basal body
Protein Families :
Tissue Specificity : Expressed in brain, lung, skeletal muscle, kidney, pancreas, testis and ovary.
Paythway :
Uniprot ID : Q9P2H0
