Recombinant Human Urokinase-type plasminogen activator (PLAU), partial

Product Description

Recombinant Human Urokinase-type plasminogen activator (PLAU), partial is available at Gentaur for Next week Delivery.

Gene Name: PLAU

Alternative Names :

Expression Region : 21-173aa

AA Sequence : SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 21.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.

Function : Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.

Involvement in disease : Quebec platelet disorder (QPD)

Subcellular location : Secreted

Protein Families : Peptidase S1 family

Tissue Specificity : Expressed in the prostate gland and prostate cancers.

Paythway : NF-kappaBsignalingpathway

Uniprot ID : P00749