Recombinant Human V-set and immunoglobulin domain-containing protein 1 (VSIG1), partial

Product Description

Recombinant Human V-set and immunoglobulin domain-containing protein 1 (VSIG1), partial is available at Gentaur for Next week Delivery.

Gene Name: VSIG1

Alternative Names : Cell surface A33 antigen (Glycoprotein A34) (GPA34)

Expression Region : 22-232aa

AA Sequence : VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Sequence Info : Extracellular Domain

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 26.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Detected only in stomach mucosa and testis, and to a much lesser level in pancreas (at protein level). Detected in gastric cancers (31%), esophageal carcinomas (50%) and ovarian cancers (23%).

Paythway :

Uniprot ID : Q86XK7