Recombinant Human V-type proton ATPase subunit F (ATP6V1F)

Product Description

Recombinant Human V-type proton ATPase subunit F (ATP6V1F) is available at Gentaur for Next week Delivery.

Gene Name: ATP6V1F

Alternative Names : V-ATPase 14KDA subunitVacuolar proton pump subunit F

Expression Region : 1-119aa

AA Sequence : MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 40.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Subunit of the peripheral V1 complex of vacuolar ATPase essential for assbly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Function : Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Involvement in disease :

Subcellular location :

Protein Families : V-ATPase F subunit family

Tissue Specificity :

Paythway : mTORsignalingpathway

Uniprot ID : Q16864