Recombinant Human Vacuolar protein sorting-associated protein 13A (VPS13A), partial

Product Description

Recombinant Human Vacuolar protein sorting-associated protein 13A (VPS13A), partial is available at Gentaur for Next week Delivery.

Gene Name: VPS13A

Alternative Names : Chorea-acanthocytosis protein Chorein

Expression Region : 3037-3140aa

AA Sequence : RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 28.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.

Function : May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.

Involvement in disease : Choreoacanthocytosis (CHAC)

Subcellular location :

Protein Families : VPS13 family

Tissue Specificity : Widely expressed. Higher expression is found in brain, heart, skeletal muscle and kidney.

Paythway :

Uniprot ID : Q96RL7