Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial

Product Description

Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial is available at Gentaur for Next week Delivery.

Gene Name: SLC27A2

Alternative Names : Fatty acid transport protein 2;FATP-2Fatty-acid-coenzyme A ligase, very long-chain 1Long-chain-fatty-acid--CoA ligase (EC:6.2.1.3)Solute carrier family 27 member 2THCA-CoA ligaseVery long-chain-fatty-acid-CoA ligase

Expression Region : 283-620aa

AA Sequence : GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 40.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across mbranes .

Function : Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precursors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes (By similarity).

Involvement in disease :

Subcellular location : Endoplasmic reticulum membrane, Multi-pass membrane protein, Peroxisome membrane, Multi-pass membrane protein

Protein Families : ATP-dependent AMP-binding enzyme family

Tissue Specificity : Expressed in liver, kidney, placenta and pancreas.

Paythway : PPARsignalingpathway

Uniprot ID : O14975