Recombinant Human Vesicle-associated membrane protein 2 (VAMP2)

Product Description

Recombinant Human Vesicle-associated membrane protein 2 (VAMP2) is available at Gentaur for Next week Delivery.

Gene Name: VAMP2

Alternative Names : Synaptobrevin-2

Expression Region : 1-116aa

AA Sequence : MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

Function : Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

Involvement in disease :

Subcellular location : Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane

Protein Families : Synaptobrevin family

Tissue Specificity : Nervous system and skeletal muscle.

Paythway : SecretedExtracellularVesicles

Uniprot ID : P63027