Product Description
Recombinant Human Vesicle-associated membrane protein 7 (VAMP7), partial is available at Gentaur for Next week Delivery.
Gene Name: VAMP7
Alternative Names : Synaptobrevin-like protein 1Tetanus-insensitive VAMP;Ti-VAMP
Expression Region : 2-186aa
AA Sequence : AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKN
Sequence Info : Cytoplasmic Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 25 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Cycle
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the targeting and/or fusion of transport vesicles to their target mbrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.
Function : Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.
Involvement in disease :
Subcellular location : Cytoplasmic vesicle, secretory vesicle membrane, Single-pass type IV membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type IV membrane protein, Late endosome membrane, Single-pass type IV membrane protein, Lysosome membrane, Single-pass type IV membrane protein, Endoplasmic reticulum membrane, Single-pass type IV membrane protein, Cytoplasmic vesicle, phagosome membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome
Protein Families : Synaptobrevin family
Tissue Specificity : Detected in all tissues tested.
Paythway :
Uniprot ID : P51809
Euro
British Pound
US Dollar