Recombinant Human Von Hippel-Lindau disease tumor suppressor (VHL)

Product Description

Recombinant Human Von Hippel-Lindau disease tumor suppressor (VHL) is available at Gentaur for Next week Delivery.

Gene Name: VHL

Alternative Names : Protein G7 pVHL

Expression Region : 1-213aa

AA Sequence : MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 28.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.

Function : Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.

Involvement in disease : Pheochromocytoma (PCC); von Hippel-Lindau disease (VHLD); Erythrocytosis, familial, 2 (ECYT2); Renal cell carcinoma (RCC)

Subcellular location : Isoform 1: Cytoplasm, Membrane, Peripheral membrane protein, Nucleus, Note=Found predominantly in the cytoplasm and with less amounts nuclear or membrane-associated, Colocalizes with ADRB2 at the cell membrane, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, Nucleus

Protein Families : VHL family

Tissue Specificity : Expressed in the adult and fetal brain and kidney.

Paythway : HIF-1signalingpathway

Uniprot ID : P40337