Recombinant Human Xaa-Pro aminopeptidase 1 (XPNPEP1)

Product Description

Recombinant Human Xaa-Pro aminopeptidase 1 (XPNPEP1) is available at Gentaur for Next week Delivery.

Gene Name: XPNPEP1

Alternative Names : Aminoacylproline aminopeptidaseCytosolic aminopeptidase PSoluble aminopeptidase P;sAmpX-Pro aminopeptidase 1X-prolyl aminopeptidase 1, soluble

Expression Region : 2-623aa

AA Sequence : PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 85.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Contributes to the degradation of bradykinin. Catalyzes the roval of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

Function : Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Peptidase M24B family

Tissue Specificity : Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas.

Paythway :

Uniprot ID : Q9NQW7