Recombinant Human Zinc finger protein 592 (ZNF592), partial

Product Description

Recombinant Human Zinc finger protein 592 (ZNF592), partial is available at Gentaur for Next week Delivery.

Gene Name: ZNF592

Alternative Names :

Expression Region : 1-242aa

AA Sequence : MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 53.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in transcriptional regulation.

Function : May be involved in transcriptional regulation.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Krueppel C2H2-type zinc-finger protein family

Tissue Specificity : Widely expressed, with highest levels in skeletal muscle. Expressed throughout the central nervous system, including in the cerebellum and cerebellar vermis, with higher expression in the substantia nigra. Widely expressed in fetal tissues.

Paythway :

Uniprot ID : Q92610