Product Description
Recombinant Human Zinc finger protein GLI2 (GLI2), partial is available at Gentaur for Next week Delivery.
Gene Name: GLI2
Alternative Names : GLI family zinc finger protein 2 Tax helper protein
Expression Region : 412-641aa
AA Sequence : EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 28.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856).
Function : Functions as transcription regulator in the hedgehog (Hh) pathway
Involvement in disease : Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)
Subcellular location : Nucleus, Cytoplasm, Cell projection, cilium
Protein Families : GLI C2H2-type zinc-finger protein family
Tissue Specificity : Expressed in breast cancers (at protein level) (PubMed:26565916). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level) (PubMed:9557682). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines (PubMed:9557682). Isoform 3 and isoform 4 are weakly expressed in HTLV-1-infected T-cell lines (PubMed:9557682).
Paythway : Hedgehogsignalingpathway
Uniprot ID : P10070
Euro
British Pound
US Dollar