Euro
British Pound
US Dollar
Product Description
Recombinant Kallikrein 2 (KLK2) is available at Gentaur for Next week Delivery.
Gene Name: Kallikrein 2
Alternative Names : KLK2A2; HK2; Prostatic Kallikrein-Related Peptidase 2; Glandular kallikrein-1; Tissue kallikrein-2
Expression Region : DYKDDDDK+Pro19~Pro261
AA Sequence :
Sequence Info :
Tag Info : N-terminal His Tag
Theoretical MW : 30.6kDa
Storage Buffer : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Endotoxin Level : <1.0EU per 1ug (determined by the LAL method)-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Enzyme & Kinase;
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P20151
