Product Description
Recombinant Klebsiella oxytoca Carbepenem-hydrolyzing beta-lactamase KPC (bla) is available at Gentaur for Next week Delivery.
Gene Name: bla
Alternative Names : Carbapenem-hydrolyzing beta-lactamase KPC-2
Expression Region : 25-293aa
AA Sequence : LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 30.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency.
Function : Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency.
Involvement in disease :
Subcellular location :
Protein Families : Class-A beta-lactamase family
Tissue Specificity :
Paythway :
Uniprot ID : Q848S6
Euro
British Pound
US Dollar