Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor ?BamA), partial

Product Description

Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor ?BamA), partial is available at Gentaur for Next week Delivery.

Gene Name: bamA

Alternative Names :

Expression Region : 24-172aa

AA Sequence : FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG

Sequence Info : Partial

Tag Info : N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged

Theoretical MW : 33.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery.

Function : Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery.

Involvement in disease :

Subcellular location : Cell outer membrane

Protein Families : BamA family

Tissue Specificity :

Paythway :

Uniprot ID : B5Y1J4