Product Description
Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor ?BamA), partial is available at Gentaur for Next week Delivery.
Gene Name: bamA
Alternative Names :
Expression Region : 24-172aa
AA Sequence : FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG
Sequence Info : Partial
Tag Info : N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged
Theoretical MW : 33.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery.
Function : Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery.
Involvement in disease :
Subcellular location : Cell outer membrane
Protein Families : BamA family
Tissue Specificity :
Paythway :
Uniprot ID : B5Y1J4
Euro
British Pound
US Dollar