Recombinant Kluyveromyces marxianus DNA-directed RNA polymerases I, II, and III subunit RPABC1 (RPB5)

Product Description

Recombinant Kluyveromyces marxianus DNA-directed RNA polymerases I, II, and III subunit RPABC1 (RPB5) is available at Gentaur for Next week Delivery.

Gene Name: RPB5

Alternative Names :

Expression Region : 1-215aa

AA Sequence : MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 29.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process

Function : DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family

Tissue Specificity :

Paythway :

Uniprot ID : Q9P4B9