Product Description
Recombinant Lecanicillium psalliotae Alkaline serine protease ver112 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 103-382aa
AA Sequence : AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQTLSTKNVLTSIPSGTVNYLAFNGAT
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 36.0 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Serine protease which can degrade the nematode cuticle.
Function : Serine protease which can degrade the nematode cuticle.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Peptidase S8 family
Tissue Specificity :
Paythway :
Uniprot ID : Q68GV9
Euro
British Pound
US Dollar