Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT

Product Description

Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Lqh-alpha-IT Short name: Alpha-IT

Expression Region : 20-85aa

AA Sequence : VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 23.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Function : Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P17728