Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1

Product Description

Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names :

Expression Region : 1-273aa

AA Sequence : WIMGHMVNNINQIEEFVSLGANSIETDVSFDKKANPEYTYHGTPCDCGRDCLRWEYFKDFLNGLRKATTPGDAKYREKLILVVFDLKTGSLYDNQAYDAGKSLAKNLLEYYWNNGNNGGRAYIVLSIPNLAHYKLVTGFKETLKDEGHEDLLEKVGHDFSGNDDIPDIESAYKKAGVTGHVWQSDGITNCLPRTLKRVILAIANRDSGSGIINKVYYWTVDKRSTTRDSLEAGVDGIMTNYPDVIADVLSEAAYKDKYRIATYDDNPWETFKA

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 34.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the hydrolysis of sphingomyelin. May also acts on other phosphatidyl esters. Induces complent-dependent holysis, dermonecrosis, blood vessel permeability and platelet aggregation .

Function : Catalyzes the hydrolysis of sphingomyelin. May also act on other phosphatidyl esters. Induces complement-dependent hemolysis, dermonecrosis, blood vessel permeability and platelet aggregation (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : Arthropod phospholipase D family, Class II subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : C0JAZ9