Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial

Product Description

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial is available at Gentaur for Next week Delivery.

Gene Name: Adamts13

Alternative Names : von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)

Expression Region : 904-1137aa

AA Sequence : WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 32.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.

Function : Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Plasma. Expression is consistently high in liver, medium in lung and spleen, low in skeletal muscle and undetectable in heart, brain, kidney and testis.

Paythway :

Uniprot ID : Q769J6