Recombinant Mouse Acid ceramidase (Asah1), partial

Product Description

Recombinant Mouse Acid ceramidase (Asah1), partial is available at Gentaur for Next week Delivery.

Gene Name: Asah1

Alternative Names : Acylsphingosine deacylase N-acylsphingosine amidohydrolase

Expression Region : 19-141aa

AA Sequence : QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM

Sequence Info : Partial

Tag Info : N-terminal 10XHis-GST-tagged and C-terminal Myc-tagged

Theoretical MW : 43.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Function : Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Involvement in disease :

Subcellular location : Lysosome

Protein Families : Acid ceramidase family

Tissue Specificity :

Paythway :

Uniprot ID : Q9WV54