Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1)

Product Description

Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1) is available at Gentaur for Next week Delivery.

Gene Name: Lypla1

Alternative Names : Lysophospholipase 1Lysophospholipase I;LPL-I;LysoPLA I

Expression Region : 1-230aa

AA Sequence : MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 51.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity .

Function : Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity (By similarity).

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : AB hydrolase superfamily, AB hydrolase 2 family

Tissue Specificity :

Paythway :

Uniprot ID : P97823