Product Description
Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial is available at Gentaur for Next week Delivery.
Gene Name: Bcl2
Alternative Names :
Expression Region : 5-205aa
AA Sequence : GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 26.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Suppresses apoptosis in a variety of cell systs including factor-dependent lymphohatopoietic and neural cells. Regulates cell death by controlling the mitochondrial mbrane permeability. Appears to function in a feedback loop syst with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).
Function : Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
Involvement in disease :
Subcellular location : Mitochondrion outer membrane, Single-pass membrane protein, Nucleus membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families : Bcl-2 family
Tissue Specificity : Expressed in a variety of tissues.
Paythway :
Uniprot ID : P10417
Euro
British Pound
US Dollar