Product Description
Recombinant Mouse Arginase-1 (Arg1) is available at Gentaur for Next week Delivery.
Gene Name: Arg1
Alternative Names : Liver-type arginaseType I arginase
Expression Region : 1-323aa
AA Sequence : MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 50.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.
Involvement in disease :
Subcellular location : Cytoplasm, Cytoplasmic granule
Protein Families : Arginase family
Tissue Specificity : Expressed in macrophages (PubMed:7537672, PubMed:12193690, PubMed:19360123). Expressed in precursor and mature group 2 innate lymphoid cells (ILC2s) (PubMed:27043409). Expressed in lung tumor-associated myeloid cells (PubMed:15313928). Expressed in lung tumor-infiltrating dendritic cells (PubMed:19414774).
Paythway :
Uniprot ID : Q61176
Euro
British Pound
US Dollar