Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial

Product Description

Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial is available at Gentaur for Next week Delivery.

Gene Name: Slc7a10

Alternative Names : D-serine transporter Solute carrier family 7 member 10

Expression Region : 475-530aa

AA Sequence : WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ

Sequence Info : Partial

Tag Info : N-terminal 6xHis-sumostar-tagged

Theoretical MW : 22.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

Function : Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

Involvement in disease :

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : Amino acid-polyamine-organocation (APC) superfamily

Tissue Specificity : Highly expressed in brain and lung, and to a lesser extent in placenta and small intestine.

Paythway :

Uniprot ID : P63115