Product Description
Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial is available at Gentaur for Next week Delivery.
Gene Name: Slc7a10
Alternative Names : D-serine transporter Solute carrier family 7 member 10
Expression Region : 475-530aa
AA Sequence : WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-sumostar-tagged
Theoretical MW : 22.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.
Function : Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : Amino acid-polyamine-organocation (APC) superfamily
Tissue Specificity : Highly expressed in brain and lung, and to a lesser extent in placenta and small intestine.
Paythway :
Uniprot ID : P63115
Euro
British Pound
US Dollar