Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

Product Description

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial is available at Gentaur for Next week Delivery.

Gene Name: Ms4a1

Alternative Names : B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20

Expression Region : 111-291aa

AA Sequence : VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 22.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This protein may be involved in the regulation of B-cell activation and proliferation.

Function : This protein may be involved in the regulation of B-cell activation and proliferation.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor

Protein Families : MS4A family

Tissue Specificity :

Paythway :

Uniprot ID : P19437