Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Beta-defensin 14 (Defb14) is available at Gentaur for Next week Delivery.
Gene Name: Defb14
Alternative Names : Defensin, beta 14
Expression Region : 23-67aa
AA Sequence : FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 21.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has antibacterial activity.
Function : Has antibacterial activity.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Beta-defensin family
Tissue Specificity :
Paythway :
Uniprot ID : Q7TNV9
