Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Beta-defensin 33 (Defb33) is available at Gentaur for Next week Delivery.
Gene Name: Defb33
Alternative Names : Defensin, beta 33
Expression Region : 21-62aa
AA Sequence : RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 24.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has antibacterial activity.
Function : Has antibacterial activity.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Beta-defensin family
Tissue Specificity :
Paythway :
Uniprot ID : Q30KN3
