Product Description
Recombinant Mouse Beta-nerve growth factor (Ngf) (Active) is available at Gentaur for Next week Delivery.
Gene Name: Ngf
Alternative Names : Beta-nerve growth factor; Beta-NGF; Ngf
Expression Region : 122-241aa
AA Sequence : SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Sequence Info : Full Length of Mature Protein
Tag Info : Tag-Free
Theoretical MW : 13.5 kDa
Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : NGF is the first member discovered in the Neurotrophin family, which includes brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3), and neurotrophin-4 (NT-4). These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. Mouse beta -NGF is a homodimer of two 120 amino acid polypeptides. It shares approximately 90% homology at the amino acid level with human beta -NGF and 95.8% with rat beta -NGF. NGF signaling has been shown to play an important role in neuroprotection and repair. ?-NGF acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. It is a potent neurotrophic factor that signals through its receptor ?-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems.
Function : Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Involvement in disease :
Subcellular location : Secreted
Protein Families : NGF-beta family
Tissue Specificity :
Paythway :
Uniprot ID : P01139