Recombinant Mouse Beta-tectorin (Tectb)

Product Description

Recombinant Mouse Beta-tectorin (Tectb) is available at Gentaur for Next week Delivery.

Gene Name: Tectb

Alternative Names :

Expression Region : 18-305aa

AA Sequence : KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 36.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.

Function : One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side, Secreted, extracellular space, extracellular matrix

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : O08524