Product Description
Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial is available at Gentaur for Next week Delivery.
Gene Name: CCL2
Alternative Names : HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor;MCAFMonocyte chemotactic protein 1;MCP-1Monocyte secretory protein JESmall-inducible cytokine A2
Expression Region : 24-96aa
AA Sequence : QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 12.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Chotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
Function : Chemotactic factor that attracts monocytes, but not neutrophils.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine beta (chemokine CC) family
Tissue Specificity :
Paythway :
Uniprot ID : P10148