Recombinant Mouse C-C motif chemokine 3 (Ccl3)

Product Description

Recombinant Mouse C-C motif chemokine 3 (Ccl3) is available at Gentaur for Next week Delivery.

Gene Name: Ccl3

Alternative Names : Heparin-binding chemotaxis protein;L2G25BMacrophage inflammatory protein 1-alpha;MIP-1-alpha;SIS-alpha;Small-inducible cytokine A3TY-5

Expression Region : 24-92aa

AA Sequence : APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Monokine with inflammatory, pyrogenic and chokinetic properties. Has a potent chotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.

Function : Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine beta (chemokine CC) family

Tissue Specificity : Expressed in lung, spleen, and pancreas.

Paythway :

Uniprot ID : P10855