Euro
British Pound
US Dollar
Product Description
Recombinant Mouse C-C motif chemokine 4 (Ccl4) is available at Gentaur for Next week Delivery.
Gene Name: Ccl4
Alternative Names : Immune activation protein 2;ACT-2;ACT2Macrophage inflammatory protein 1-beta;MIP-1-betaProtein H400SIS-gamma;Small-inducible cytokine A4
Expression Region : 24-92aa
AA Sequence : APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 11.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Monokine with inflammatory and chokinetic properties.
Function : Monokine with inflammatory and chemokinetic properties.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine beta (chemokine CC) family
Tissue Specificity :
Paythway :
Uniprot ID : P14097
