Recombinant Mouse C-X-C motif chemokine 16 (Cxcl16), partial

Product Description

Recombinant Mouse C-X-C motif chemokine 16 (Cxcl16), partial is available at Gentaur for Next week Delivery.

Gene Name: Cxcl16

Alternative Names : Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein;SR-PSOXSmall-inducible cytokine B16Transmembrane chemokine CXCL16

Expression Region : 27-198aa

AA Sequence : NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 22.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Induces a strong chotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis.

Function : Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity : Widely expressed. Not detected in purified B- and T-cells.

Paythway :

Uniprot ID : Q8BSU2