Product Description
Recombinant Mouse C-X-C motif chemokine 16 (Cxcl16), partial is available at Gentaur for Next week Delivery.
Gene Name: Cxcl16
Alternative Names : Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein;SR-PSOXSmall-inducible cytokine B16Transmembrane chemokine CXCL16
Expression Region : 27-198aa
AA Sequence : NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Induces a strong chotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis.
Function : Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Intercrine alpha (chemokine CxC) family
Tissue Specificity : Widely expressed. Not detected in purified B- and T-cells.
Paythway :
Uniprot ID : Q8BSU2
Euro
British Pound
US Dollar