Product Description
Recombinant Mouse C-X-C motif chemokine 9 (Cxcl9) is available at Gentaur for Next week Delivery.
Gene Name: Cxcl9
Alternative Names : Gamma-interferon-induced monokine;Monokine induced by interferon-gamma;MIG;MuMIGProtein m119Small-inducible cytokine B9
Expression Region : 22-126aa
AA Sequence : TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be a cytokine that affects the growth, movent, or activation state of cells that participate in immune and inflammatory response.
Function : May be a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine alpha (chemokine CxC) family
Tissue Specificity :
Paythway :
Uniprot ID : P18340
Euro
British Pound
US Dollar