Recombinant Mouse C-X-C motif chemokine 9 (Cxcl9)

Product Description

Recombinant Mouse C-X-C motif chemokine 9 (Cxcl9) is available at Gentaur for Next week Delivery.

Gene Name: Cxcl9

Alternative Names : Gamma-interferon-induced monokine;Monokine induced by interferon-gamma;MIG;MuMIGProtein m119Small-inducible cytokine B9

Expression Region : 22-126aa

AA Sequence : TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be a cytokine that affects the growth, movent, or activation state of cells that participate in immune and inflammatory response.

Function : May be a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity :

Paythway :

Uniprot ID : P18340