Product Description
Recombinant Mouse Calcium/calmodulin-dependent protein kinase II inhibitor 1 (Camk2n1) is available at Gentaur for Next week Delivery.
Gene Name: Camk2n1
Alternative Names : calcium/calmodulin-dependent protein kinase II inhibitor alpha;mCaMKIINalpha
Expression Region : 1-78aa
AA Sequence : MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 24.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Potent and specific inhibitor of CaM-kinase II (CAMK2).
Function : Potent and specific inhibitor of CaM-kinase II (CAMK2).
Involvement in disease :
Subcellular location : Cell junction, synapse, synaptosome, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density
Protein Families : CAMK2N family
Tissue Specificity : Brain specific (at protein level).
Paythway :
Uniprot ID : Q6QWF9