Recombinant Mouse Cathepsin S (Ctss)

Product Description

Recombinant Mouse Cathepsin S (Ctss) is available at Gentaur for Next week Delivery.

Gene Name: ctss

Alternative Names :

Expression Region : 123-340aa

AA Sequence : LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 27.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

Function : Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

Involvement in disease :

Subcellular location : Lysosome

Protein Families : Peptidase C1 family

Tissue Specificity : Widely expressed with highest expression found in non-skeletal tissues. Relatively high levels found in skeletal tissues.

Paythway :

Uniprot ID : O70370