Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1)

Product Description

Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1) is available at Gentaur for Next week Delivery.

Gene Name: Cnrip1

Alternative Names :

Expression Region : 1-464aa

AA Sequence : MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 22.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

Function : Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

Involvement in disease :

Subcellular location :

Protein Families : CNRIP family

Tissue Specificity : Highly expressed in brain. Also detected in heart, lung, intestine, kidney, testis, spleen, liver and muscle (at protein level).

Paythway :

Uniprot ID : Q5M8N0