Recombinant Mouse CD81 antigen (Cd81), partial

Product Description

Recombinant Mouse CD81 antigen (Cd81), partial is available at Gentaur for Next week Delivery.

Gene Name: Cd81

Alternative Names : 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1; CD81

Expression Region : 116-201aa

AA Sequence : KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 36.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.

Function : May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.

Involvement in disease :

Subcellular location : Basolateral cell membrane, Multi-pass membrane protein

Protein Families : Tetraspanin (TM4SF) family

Tissue Specificity : Expressed in oocytes. Highly expressed in granulosa cells.

Paythway :

Uniprot ID : P35762