Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Chymase (Cma1), partial is available at Gentaur for Next week Delivery.
Gene Name: Cma1
Alternative Names : Alpha-chymase;Mast cell chymase 1Mast cell protease 5;mMCP-5Mast cell protease I
Expression Region : 22-246aa
AA Sequence : IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 29.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Function : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Involvement in disease :
Subcellular location : Secreted, Cytoplasmic granule
Protein Families : Peptidase S1 family, Granzyme subfamily
Tissue Specificity : Mast cells.
Paythway :
Uniprot ID : P21844
