Product Description
Recombinant Mouse Complement receptor type 2 (Cr2), partial is available at Gentaur for Next week Delivery.
Gene Name: Cr2
Alternative Names : Complement C3d receptor CD_antigen: CD21
Expression Region : 12-145aa
AA Sequence : ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 18.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for complement C3d. Participates in B lymphocytes activation.
Function : Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Receptors of complement activation (RCA) family
Tissue Specificity : B-lymphocytes.
Paythway :
Uniprot ID : P19070