Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial

Product Description

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is available at Gentaur for Next week Delivery.

Gene Name: Ctla4

Alternative Names : Cytotoxic T-lymphocyte-associated antigen 4

Expression Region : 36-161aa

AA Sequence : EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Sequence Info : Extracellular Domain

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 33.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28

Function : Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Widely expressed with highest levels in lymphoid tissues.

Paythway :

Uniprot ID : P09793