Recombinant Mouse Decorin (Dcn), partial

Product Description

Recombinant Mouse Decorin (Dcn), partial is available at Gentaur for Next week Delivery.

Gene Name: Dcn

Alternative Names : Bone proteoglycan IIPG-S2;PG40

Expression Region : 35-354aa

AA Sequence : GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 39.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May affect the rate of fibrils formation.

Function : May affect the rate of fibrils formation.

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P28654