Product Description
Recombinant Mouse Decorin (Dcn)?partial is available at Gentaur for Next week Delivery.
Gene Name: Dcn
Alternative Names : Bone proteoglycan IIPG-S2;PG40
Expression Region : 35-354aa
AA Sequence : GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Sequence Info : partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 37.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May affect the rate of fibrils formation.
Function : May affect the rate of fibrils formation.
Involvement in disease :
Subcellular location : Secreted, extracellular space, extracellular matrix
Protein Families : Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P28654
Euro
British Pound
US Dollar