Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial

Product Description

Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial is available at Gentaur for Next week Delivery.

Gene Name: Ecel1

Alternative Names : Damage-induced neuronal endopeptidase Xce protein Dine, Xce

Expression Region : 1-61aa

AA Sequence : MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 13.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.

Function : May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families : Peptidase M13 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9JMI0