Recombinant Mouse Ephrin-A1 (Efna1), partial (Active)

Product Description

Recombinant Mouse Ephrin-A1 (Efna1), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: Efna1

Alternative Names : EPH-related receptor tyrosine kinase ligand 1; Immediate early response protein B61;Epgl1; Epl1; Lerk1

Expression Region : 19-182aa

AA Sequence : DRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS

Sequence Info : Partial

Tag Info : C-terminal 6xHis-FC-tagged

Theoretical MW : 47.3 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human EphA2 in functional ELISA is less than 20 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ephrin-A1 is a cell membrane protein and contains 1 ephrin RBD (ephrin receptor-binding) domain. EFNA1 belongs to the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.It belongs to the ephrin family and contains 1 ephrin RBD (ephrin receptor-binding) domain.

Function : Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Ephrin-A1, secreted form: Secreted

Protein Families : Ephrin family

Tissue Specificity : Expressed in myogenic progenitor cells.

Paythway :

Uniprot ID : P52793